PDB entry 5juc

View 5juc on RCSB PDB site
Description: crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and glucosyl-3-phosphoglycerate (gpg) - gpgs*gpg*udp*mn2+_2
Deposited on 2016-05-10, released 2017-05-24
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucosyl-3-phosphoglycerate synthase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: gpgS, Rv1208
    Database cross-references and differences (RAF-indexed):
  • Heterogens: UDP, EDO, MN, XDX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jucA (A:)
    gsgamtaselvagdlaggrapgalpldttwhrpgwtigeleaakagrtisvvlpalneea
    tiesvidsisplvdglvdelivldsgstddteiraiasgarvvsreqalpevpvrpgkge
    alwrslaatsgdivvfidsdlinphplfvpwlvgplltgegiqlvksfyrrplqvsdvts
    gvcatgggrvtelvarpllaalrpelgcvlqplsgeyaasrelltslpfapgygveigll
    idtfdrlgldaiaqvnlgvrahrnrpldelgamsrqviatllsrcgipdsgvgltqflpg
    gpddsdytrhtwpvslvdrppmkvmrpr
    

    Sequence, based on observed residues (ATOM records):
    >5jucA (A:)
    pldttwhrpgwtigeleaakagrtisvvlpalneeatiesvidsisplvdglvdelivld
    sgstddteiraiasgarvvsreqalpevpvrpgkgealwrslaatsgdivvfidsdlinp
    hplfvpwlvgplltgegiqlvksfyrggrvtelvarpllaalrpelgcvlqplsgeyaas
    relltslpfapgygveigllidtfdrlgldaiaqvnlgvrahrnrpldelgamsrqviat
    llsrcgipdsgvgltqflytrhtwpvslvdrppmkvmr