PDB entry 5ju7

View 5ju7 on RCSB PDB site
Description: DNA binding domain of e.coli cadc
Class: transcription
Keywords: cadc, helix-turn-helix motif, toxr-like, DNA-binding transcriptional activator, cadba promotor DNA, cytoplasmic, transcription
Deposited on 2016-05-10, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator cadC
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: cadC, b4133, JW4094
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23890 (4-109)
      • expression tag (3)
    Domains in SCOPe 2.07: d5ju7a1, d5ju7a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5ju7A (A:)
gamaqqpvvrvgewlvtpsinqisrngrqltleprlidllvffaqhsgevlsrdelidnv
wkrsivtnhvvtqsiselrkslkdndedspvyiatvpkrgyklmvpviwy

    Sequence, based on observed residues (ATOM records): (download) 
    >5ju7A (A:)
aqqpvvrvgewlvtpsinqisrngrqltleprlidllvffaqhsgevlsrdelidnvwkr
sivtnhvvtqsiselrkslkdndedspvyiatvpkrgyklmvpviwy