PDB entry 5jty

View 5jty on RCSB PDB site
Description: Glutamate- and DCKA-bound GluN1/GluN2A agonist binding domains with MPX-007
Class: transport protein, receptor
Keywords: NMDA receptor, Antagonist, TRANSPORT PROTEIN, RECEPTOR
Deposited on 2016-05-10, released 2016-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grin1, Nmdar1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtya_
  • Chain 'B':
    Compound: Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor ionotropic, NMDA 2A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grin2a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00959 (Start-138)
      • linker (139-140)
    • Uniprot Q00959 (141-280)
      • see remark 999 (238)
    Domains in SCOPe 2.08: d5jtyb_
  • Heterogens: 2JK, 6ND, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jtyA (A:)
    gmstrlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvp
    qccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadm
    ivapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqss
    vdiyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvt
    tgelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jtyA (A:)
    trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgphtvpqccygfcidlli
    klartmnftyevhlvadgkfgtqekkewngmmgellsgqadmivapltinneraqyiefs
    kpfkyqgltilvktritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmek
    hnyesaaeaiqavrdnklhafiwdsavlefeaslvttgelffrsgfgigmrkdspwkqnv
    slsilkshengfmedldktwvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jtyB (B:)
    sddnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfc
    idilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineerse
    vvdfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnyp
    ymhqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifatt
    gygialqkgspwkrqidlallqfvgdgemeeletlwltgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jtyB (B:)
    dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
    ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
    dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
    hqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigifattgygia
    lqkgspwkrqidlallqfvgdgemeeletlwltgic