PDB entry 5jtt

View 5jtt on RCSB PDB site
Description: Crystal structure of GPb in complex with 8a
Class: transferase
Keywords: alpha and beta protein transferase, transferase
Deposited on 2016-05-09, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jtta_
  • Heterogens: PLP, 6MY, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jttA (A:)
    msrplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtv
    rdhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldm
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeea
    ddwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvn
    tmrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerl
    dwdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafp
    gdvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkf
    qnktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkq
    enklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvv
    prtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipa
    adlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvd
    rldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyee
    yvkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapde
    kip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jttA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnf
    dafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealer
    wpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlci
    agshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaer
    igeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvq
    vkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitai
    gdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlnga
    ltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqls
    sgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirnia
    tsgkfssdrtiaqyareiwgvepsrqrlpa