PDB entry 5jtr

View 5jtr on RCSB PDB site
Description: The structure of chaperone SecB in complex with unstructured MBP binding site e
Class: chaperone/protein binding
Keywords: Molecular Chaperone, CHAPERONE-PROTEIN BINDING complex
Deposited on 2016-05-09, released 2016-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtra_
  • Chain 'B':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtrb_
  • Chain 'C':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtrc_
  • Chain 'D':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtrd_
  • Chain 'E':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: malE, Z5632, ECs5017
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: malE, Z5632, ECs5017
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: malE, Z5632, ECs5017
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: malE, Z5632, ECs5017
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtrA (A:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtrB (B:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtrC (C:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtrD (D:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.