PDB entry 5jtr
View 5jtr on RCSB PDB site
Description: The structure of chaperone SecB in complex with unstructured MBP binding site e
Class: chaperone/protein binding
Keywords: Molecular Chaperone, CHAPERONE-PROTEIN BINDING complex
Deposited on
2016-05-09, released
2016-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated
2016-09-21, with a file datestamp of
2016-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein-export protein secb
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: secB, Z5036, ECs4487
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5jtra_ - Chain 'B':
Compound: protein-export protein secb
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: secB, Z5036, ECs4487
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5jtrb_ - Chain 'C':
Compound: protein-export protein secb
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: secB, Z5036, ECs4487
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5jtrc_ - Chain 'D':
Compound: protein-export protein secb
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: secB, Z5036, ECs4487
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5jtrd_ - Chain 'E':
Compound: Maltose-binding periplasmic protein
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: malE, Z5632, ECs5017
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Maltose-binding periplasmic protein
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: malE, Z5632, ECs5017
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: Maltose-binding periplasmic protein
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: malE, Z5632, ECs5017
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Maltose-binding periplasmic protein
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: malE, Z5632, ECs5017
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5jtrA (A:)
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5jtrB (B:)
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5jtrC (C:)
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5jtrD (D:)
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.