PDB entry 5jto

View 5jto on RCSB PDB site
Description: The structure of chaperone SecB in complex with unstructured proPhoA binding site d
Class: chaperone/hydrolase
Keywords: Molecular chaperone, CHAPERONE-HYDROLASE complex
Deposited on 2016-05-09, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein-export protein secb
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: secB, Z5036, ECs4487
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG88 (0-154)
  Domains in SCOPe 2.07: d5jtoa_
• Chain 'B':
  Compound: protein-export protein secb
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: secB, Z5036, ECs4487
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG88 (0-154)
  Domains in SCOPe 2.07: d5jtob_
• Chain 'C':
  Compound: protein-export protein secb
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: secB, Z5036, ECs4487
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG88 (0-154)
  Domains in SCOPe 2.07: d5jtoc_
• Chain 'D':
  Compound: protein-export protein secb
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: secB, Z5036, ECs4487
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG88 (0-154)
  Domains in SCOPe 2.07: d5jtod_
• Chain 'E':
  Compound: alkaline phosphatase
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: phoA, b0383, JW0374
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00634 (0-39)
• Chain 'F':
  Compound: alkaline phosphatase
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: phoA, b0383, JW0374
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00634 (0-39)
• Chain 'G':
  Compound: alkaline phosphatase
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: phoA, b0383, JW0374
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00634 (0-39)
• Chain 'H':
  Compound: alkaline phosphatase
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: phoA, b0383, JW0374
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00634 (0-39)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jtoA (A:)
  mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
  rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
  gtfpqlnlapvnfdalfmnylqqqagegteehqda
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jtoB (B:)
  mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
  rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
  gtfpqlnlapvnfdalfmnylqqqagegteehqda
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jtoC (C:)
  mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
  rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
  gtfpqlnlapvnfdalfmnylqqqagegteehqda
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jtoD (D:)
  mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
  rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
  gtfpqlnlapvnfdalfmnylqqqagegteehqda
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.