PDB entry 5jto

View 5jto on RCSB PDB site
Description: The structure of chaperone SecB in complex with unstructured proPhoA binding site d
Class: chaperone/hydrolase
Keywords: Molecular chaperone, CHAPERONE-HYDROLASE complex
Deposited on 2016-05-09, released 2016-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtoa_
  • Chain 'B':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtob_
  • Chain 'C':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtoc_
  • Chain 'D':
    Compound: protein-export protein secb
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: secB, Z5036, ECs4487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jtod_
  • Chain 'E':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtoA (A:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtoB (B:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtoC (C:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jtoD (D:)
    mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
    rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
    gtfpqlnlapvnfdalfmnylqqqagegteehqda
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.