PDB entry 5jtf

View 5jtf on RCSB PDB site
Description: Crystal structure of ArsN N-acetyltransferase from Pseudomonas putida KT2440
Class: transferase
Keywords: N-acetyltransferase, Pseudomonas putida, TRANSFERASE
Deposited on 2016-05-09, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative phosphinothricin n-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jtfa_
  • Chain 'B':
    Compound: putative phosphinothricin n-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jtfb_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jtfA (A:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jtfA (A:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jtfB (B:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jtfB (B:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdglhpeaplgfl