PDB entry 5jt9

View 5jt9 on RCSB PDB site
Description: Thermolysin in complex with JC106.
Class: hydrolase
Keywords: hydrolase, metalloprotease, hydrolase inhibitor complex
Deposited on 2016-05-09, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: thermolysin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jt9e_
  • Heterogens: ZN, CA, GOL, DMS, 7AF, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jt9E (E:)
    itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
    qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
    vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
    nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
    aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
    qevasvkqafdavgvk