PDB entry 5jt8

View 5jt8 on RCSB PDB site
Description: structural basis for the limited antibody cross reactivity between the mite allergens blo t 1 and der p 1
Deposited on 2016-05-09, released 2017-05-24
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blo t 1 allergen
    Species: Blomia tropicalis [TaxId:40697]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1KXI0 (Start-332)
      • conflict (174)
      • conflict (202)
      • conflict (214)
      • conflict (233)
      • conflict (326)
  • Chain 'B':
    Compound: Blo t 1 allergen
    Species: Blomia tropicalis [TaxId:40697]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1KXI0 (Start-332)
      • conflict (174)
      • conflict (202)
      • conflict (214)
      • conflict (233)
      • conflict (326)
  • Heterogens: NAG, CL, NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jt8A (A:)
    mkfllvaalcalvaigsckptreeiktfeqfkkvfgkvyrnaeeearrehhfkeqlkwve
    ehngidgveyaineysdmseqefsfhlsggglnftymkmeaakeplintygslpqnfdwr
    qkarltrirqqgscgscwafaaagvaeslysiqkqqsielseqelvdctynrydpsyqcn
    gcgsgysteafkymirtglveernypynmrtqwcdpdvegqryhvsgyqqlryhssdedv
    mytiqqhgpvviymhgsnnyfrnlgngvlrgvayndaytdhavilvgwgtvqgvdywiir
    nswgtgwgnggygyverghnslginnyvtyatl
    

    Sequence, based on observed residues (ATOM records):
    >5jt8A (A:)
    eiktfeqfkkvfgkvyrnaeeearrehhfkeqlkwveehngidgveyaineysdmseqef
    sfhlsggglnftymkmeaakeplintygslpqnfdwrqkarltrirqqgscgscwafaaa
    gvaeslysiqkqqsielseqelvdctynrydpsyqcngcgsgysteafkymirtglveer
    nypynmrtqwcdpdvegqryhvsgyqqlryhssdedvmytiqqhgpvviymhgsnnyfrn
    lgngvlrgvayndaytdhavilvgwgtvqgvdywiirnswgtgwgnggygyverghnslg
    innyvtyatl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jt8B (B:)
    mkfllvaalcalvaigsckptreeiktfeqfkkvfgkvyrnaeeearrehhfkeqlkwve
    ehngidgveyaineysdmseqefsfhlsggglnftymkmeaakeplintygslpqnfdwr
    qkarltrirqqgscgscwafaaagvaeslysiqkqqsielseqelvdctynrydpsyqcn
    gcgsgysteafkymirtglveernypynmrtqwcdpdvegqryhvsgyqqlryhssdedv
    mytiqqhgpvviymhgsnnyfrnlgngvlrgvayndaytdhavilvgwgtvqgvdywiir
    nswgtgwgnggygyverghnslginnyvtyatl
    

    Sequence, based on observed residues (ATOM records):
    >5jt8B (B:)
    reeiktfeqfkkvfgkvyrnaeeearrehhfkeqlkwveehngidgveyaineysdmseq
    efsfhlsggglnftymkmeaakeplintygslpqnfdwrqkarltrirqqgscgscwafa
    aagvaeslysiqkqqsielseqelvdctynrydpsyqcngcgsgysteafkymirtglve
    ernypynmrtqwcdpdvegqryhvsgyqqlryhssdedvmytiqqhgpvviymhgsnnyf
    rnlgngvlrgvayndaytdhavilvgwgtvqgvdywiirnswgtgwgnggygyverghns
    lginnyvtyatl