PDB entry 5jsx

View 5jsx on RCSB PDB site
Description: crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+ and uridine- diphosphate-glucose (udp-glc)
Deposited on 2016-05-09, released 2017-05-24
The last revision was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucosyl-3-phosphoglycerate synthase
    Species: Mycobacterium tuberculosis H37Ra [TaxId:419947]
    Gene: MRA_1217
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, UPG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jsxA (A:)
    gsgamtaselvagdlaggrapgalpldttwhrpgwtigeleaakagrtisvvlpalneea
    tiesvidsisplvdglvdelivldsgstddteiraiasgarvvsreqalpevpvrpgkge
    alwrslaatsgdivvfidsdlinphplfvpwlvgplltgegiqlvksfyrrplqvsdvts
    gvcatgggrvtelvarpllaalrpelgcvlqplsgeyaasrelltslpfapgygveigll
    idtfdrlgldaiaqvnlgvrahrnrpldelgamsrqviatllsrcgipdsgvgltqflpg
    gpddsdytrhtwpvslvdrppmkvmrpr
    

    Sequence, based on observed residues (ATOM records):
    >5jsxA (A:)
    alpldttwhrpgwtigeleaakagrtisvvlpalneeatiesvidsisplvdglvdeliv
    ldsgstddteiraiasgarvvsreqalpevpvrpgkgealwrslaatsgdivvfidsdli
    nphplfvpwlvgplltgegiqlvksfyrggrvtelvarpllaalrpelgcvlqplsgeya
    asrelltslpfapgygveigllidtfdrlgldaiaqvnlgvrahrnrpldelgamsrqvi
    atllsrcgipdsgvgltqflpdytrhtwpvslvdrppmkvmr