PDB entry 5jsf

View 5jsf on RCSB PDB site
Description: Crystal structure of 17beta-hydroxysteroid dehydrogenase 14 S205 variant in complex with NAD.
Class: oxidoreductase
Keywords: cofactor complex, hydroxysteroid dehydrogenase, oxidoreductase
Deposited on 2016-05-08, released 2016-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1 (Start-271)
      • conflict (206)
      • expression tag (272)
    Domains in SCOPe 2.06: d5jsfa1, d5jsfa2
  • Heterogens: NAD, NA, PGE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jsfA (A:)
    ghmatgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavf
    ilcdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgt
    ytltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvr
    vncispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfc
    tgiellvtggaelgygckasrstpvdapdipsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jsfA (A:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckasrstpvdapdipsg