PDB entry 5js4

View 5js4 on RCSB PDB site
Description: crystal structure of phiab6 tailspike
Deposited on 2016-05-07, released 2017-03-08
The last revision was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phiAB6 tailspike
    Species: unidentified phage [TaxId:38018]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JS4 (Start-718)
  • Chain 'B':
    Compound: phiAB6 tailspike
    Species: unidentified phage [TaxId:38018]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JS4 (Start-718)
  • Chain 'C':
    Compound: phiAB6 tailspike
    Species: unidentified phage [TaxId:38018]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JS4 (Start-718)
  • Heterogens: MLA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5js4A (A:)
    mgsshhhhhhssglvprgshmnilrsftetvvttptdifpisfeydekydavhvflndva
    vedlgytvsqvnavtlkiepaipdgtvrieretdidkmkyifdagalfidqnvdadfrqi
    vhsqqevrdgfiklrgdvlplvhglqealqqaqeaseaaqeaanaaevaasqtqyylkyf
    npeivypknarimldngdivrstvvnntsnpnvdmtgwvkvssvsqifdetynitqsvin
    gnlitvdnfgakgdgvtddsaafqaycdsaltgqnlylgakgryilknqvdlkgkglvgn
    gcgkvsefyynlgcidvdgsspdlqgktafincgptiqnltarcsngagkqvsfieidgy
    lanidhitlinfynqivvkqalvgfnftnawlyysqnagiycedplnrvsttgtfhniyf
    qlgdghamifdrdvhgcdfdniifesmnggikartvahcgfgkfwcenlktatskdwlev
    tganscygnsftgyvkllggwtsktsptldslptnnyggvsvsaegisivnagnkakmlm
    lpsgfktgnatidethissstvtplvkrrvigadssgaqylasdtytklsrkwgtynhgs
    nnagafyapmmltydqsfstpqnnngwkivkestgvyrvervsgntsvitnghivvgspl
    mgsrlgtgtgathgiqmietyagswtsyteaagfkvfwrdssnalvdphrftvaftats
    

    Sequence, based on observed residues (ATOM records):
    >5js4A (A:)
    tqyylkyfnpeivypknarimldngdivrstvvnntsnpnvdmtgwvkvssvsqifdety
    nitqsvingnlitvdnfgakgdgvtddsaafqaycdsaltgqnlylgakgryilknqvdl
    kgkglvgngcgkvsefyynlgcidvdgsspdlqgktafincgptiqnltarcsngagkqv
    sfieidgylanidhitlinfynqivvkqalvgfnftnawlyysqnagiycedplnrvstt
    gtfhniyfqlgdghamifdrdvhgcdfdniifesmnggikartvahcgfgkfwcenlkta
    tskdwlevtganscygnsftgyvkllggwtsktsptldslptnnyggvsvsaegisivna
    gnkakmlmlpsgfktgnatidethissstvtplvkrrvigadssgaqylasdtytklsrk
    wgtynhgsnnagafyapmmltydqsfstpqnnngwkivkestgvyrvervsgntsvitng
    hivvgsplmgsrlgtgtgathgiqmietyagswtsyteaagfkvfwrdssnalvdphrft
    vaftats
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5js4B (B:)
    mgsshhhhhhssglvprgshmnilrsftetvvttptdifpisfeydekydavhvflndva
    vedlgytvsqvnavtlkiepaipdgtvrieretdidkmkyifdagalfidqnvdadfrqi
    vhsqqevrdgfiklrgdvlplvhglqealqqaqeaseaaqeaanaaevaasqtqyylkyf
    npeivypknarimldngdivrstvvnntsnpnvdmtgwvkvssvsqifdetynitqsvin
    gnlitvdnfgakgdgvtddsaafqaycdsaltgqnlylgakgryilknqvdlkgkglvgn
    gcgkvsefyynlgcidvdgsspdlqgktafincgptiqnltarcsngagkqvsfieidgy
    lanidhitlinfynqivvkqalvgfnftnawlyysqnagiycedplnrvsttgtfhniyf
    qlgdghamifdrdvhgcdfdniifesmnggikartvahcgfgkfwcenlktatskdwlev
    tganscygnsftgyvkllggwtsktsptldslptnnyggvsvsaegisivnagnkakmlm
    lpsgfktgnatidethissstvtplvkrrvigadssgaqylasdtytklsrkwgtynhgs
    nnagafyapmmltydqsfstpqnnngwkivkestgvyrvervsgntsvitnghivvgspl
    mgsrlgtgtgathgiqmietyagswtsyteaagfkvfwrdssnalvdphrftvaftats
    

    Sequence, based on observed residues (ATOM records):
    >5js4B (B:)
    tqyylkyfnpeivypknarimldngdivrstvvnntsnpnvdmtgwvkvssvsqifdety
    nitqsvingnlitvdnfgakgdgvtddsaafqaycdsaltgqnlylgakgryilknqvdl
    kgkglvgngcgkvsefyynlgcidvdgsspdlqgktafincgptiqnltarcsngagkqv
    sfieidgylanidhitlinfynqivvkqalvgfnftnawlyysqnagiycedplnrvstt
    gtfhniyfqlgdghamifdrdvhgcdfdniifesmnggikartvahcgfgkfwcenlkta
    tskdwlevtganscygnsftgyvkllggwtsktsptldslptnnyggvsvsaegisivna
    gnkakmlmlpsgfktgnatidethissstvtplvkrrvigadssgaqylasdtytklsrk
    wgtynhgsnnagafyapmmltydqsfstpqnnngwkivkestgvyrvervsgntsvitng
    hivvgsplmgsrlgtgtgathgiqmietyagswtsyteaagfkvfwrdssnalvdphrft
    vaftats
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5js4C (C:)
    mgsshhhhhhssglvprgshmnilrsftetvvttptdifpisfeydekydavhvflndva
    vedlgytvsqvnavtlkiepaipdgtvrieretdidkmkyifdagalfidqnvdadfrqi
    vhsqqevrdgfiklrgdvlplvhglqealqqaqeaseaaqeaanaaevaasqtqyylkyf
    npeivypknarimldngdivrstvvnntsnpnvdmtgwvkvssvsqifdetynitqsvin
    gnlitvdnfgakgdgvtddsaafqaycdsaltgqnlylgakgryilknqvdlkgkglvgn
    gcgkvsefyynlgcidvdgsspdlqgktafincgptiqnltarcsngagkqvsfieidgy
    lanidhitlinfynqivvkqalvgfnftnawlyysqnagiycedplnrvsttgtfhniyf
    qlgdghamifdrdvhgcdfdniifesmnggikartvahcgfgkfwcenlktatskdwlev
    tganscygnsftgyvkllggwtsktsptldslptnnyggvsvsaegisivnagnkakmlm
    lpsgfktgnatidethissstvtplvkrrvigadssgaqylasdtytklsrkwgtynhgs
    nnagafyapmmltydqsfstpqnnngwkivkestgvyrvervsgntsvitnghivvgspl
    mgsrlgtgtgathgiqmietyagswtsyteaagfkvfwrdssnalvdphrftvaftats
    

    Sequence, based on observed residues (ATOM records):
    >5js4C (C:)
    tqyylkyfnpeivypknarimldngdivrstvvnntsnpnvdmtgwvkvssvsqifdety
    nitqsvingnlitvdnfgakgdgvtddsaafqaycdsaltgqnlylgakgryilknqvdl
    kgkglvgngcgkvsefyynlgcidvdgsspdlqgktafincgptiqnltarcsngagkqv
    sfieidgylanidhitlinfynqivvkqalvgfnftnawlyysqnagiycedplnrvstt
    gtfhniyfqlgdghamifdrdvhgcdfdniifesmnggikartvahcgfgkfwcenlkta
    tskdwlevtganscygnsftgyvkllggwtsktsptldslptnnyggvsvsaegisivna
    gnkakmlmlpsgfktgnatidethissstvtplvkrrvigadssgaqylasdtytklsrk
    wgtynhgsnnagafyapmmltydqsfstpqnnngwkivkestgvyrvervsgntsvitng
    hivvgsplmgsrlgtgtgathgiqmietyagswtsyteaagfkvfwrdssnalvdphrft
    vaftats