PDB entry 5jrv

View 5jrv on RCSB PDB site
Description: Crystal structure of Fe(II) NO-bound H-NOX protein from C. subterraneus
Class: signaling protein
Keywords: Heme-based methyl-accepting chemotaxis protein Gas binding Signaling protein, SIGNALING PROTEIN
Deposited on 2016-05-06, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jrva_
  • Chain 'B':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jrvb_
  • Heterogens: HEM, NO, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jrvA (A:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jrvB (B:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn