PDB entry 5jru

View 5jru on RCSB PDB site
Description: Crystal structure of Fe(II) unliganded H-NOX protein from C. subterraneus
Class: signaling protein
Keywords: Heme-based methyl-accepting chemotaxis protein Gas binding Signaling protein, SIGNALING PROTEIN
Deposited on 2016-05-06, released 2016-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 2.3099999999999996 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jrua_
  • Chain 'B':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jrub_
  • Chain 'C':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jruc_
  • Chain 'D':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jrud_
  • Chain 'E':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jrue_
  • Chain 'F':
    Compound: methyl-accepting chemotaxis protein
    Species: Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) [TaxId:273068]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jruf_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jruA (A:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jruA (A:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jruB (B:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jruB (B:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jruC (C:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jruC (C:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jruD (D:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jruD (D:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5jruE (E:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jruE (E:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeyk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jruF (F:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jruF (F:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykk