PDB entry 5jrr

View 5jrr on RCSB PDB site
Description: crystal structure of native laccase from thermus thermophilus hb27
Deposited on 2016-05-06, released 2017-05-10
The last revision was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laccase
    Species: Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) [TaxId:262724]
    Gene: TT_C1370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72HW2 (0-438)
      • conflict (29)
  • Heterogens: CU, MPD, MRD, OXY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jrrA (A:)
    gpsfpepkvvrsqggllslklsatptplaiagqratlltyggsfpgptlrvrprdtvrlt
    lenrlpeptnlhwhglpispkvddpfleippgeswtyeftvpkelagtfwyhphlhgrva
    pqlfagllgalvvessldaipelreaeehllvlkdlalqggrpaphtpmdwmngkegdlv
    lvngalrptlvaqkatlrlrllnasnaryyrlalqdhplyliaadggfleeplevselll
    apgeraevlvrlrkegrfllqalpydrgamgmmdmggmahampqgpsrpetllyliapkn
    pkplplpkalspfptlpapvvtrrlvltedmmaarffingqvfdhrrvdlkgqaqtvevw
    evenqgdmdhpfhlhvhpfqvlsvggrpfpyrawkdvvnlkagevarllvplrekgrtvf
    hchivehedrgmmgvlevg