PDB entry 5jro

View 5jro on RCSB PDB site
Description: The crystal structure of azoreductase from Yersinia pestis CO92 in its Apo form
Class: oxidoreductase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2016-05-06, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent NADH-azoreductase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: azoR, YPO2323, y2010, YP_2110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZE60 (3-203)
      • expression tag (2)
    Domains in SCOPe 2.07: d5jroa1, d5jroa2
  • Chain 'B':
    Compound: FMN-dependent NADH-azoreductase
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: azoR, YPO2323, y2010, YP_2110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZE60 (3-203)
      • expression tag (2)
    Domains in SCOPe 2.07: d5jrob1, d5jrob2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jroA (A:)
    snamskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvg
    alrpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragv
    tfrytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegi
    aygpevatkaqadaktllaqvvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jroA (A:)
    amskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgal
    rpgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr
    ytekgpeglvtgkraiiltsrgtptdlvvpylrlflgfigitdvefvfaegadaktllaq
    vvaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jroB (B:)
    snamskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvg
    alrpsgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragv
    tfrytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegi
    aygpevatkaqadaktllaqvvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jroB (B:)
    amskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgal
    rpsaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfry
    tekgpeglvtgkraiiltsrgtptdlvvpylrlflgfigitdvefvfaeadaktllaqvv
    aa