PDB entry 5jrn

View 5jrn on RCSB PDB site
Description: Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution
Class: hydrolase
Keywords: Xylanase, Complex, GH11, Hydrolase
Deposited on 2016-05-06, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Fusarium oxysporum f. sp. vasinfectum 25433 [TaxId:1089449]
    Gene: FOTG_15646
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jrna_
  • Heterogens: GOL, 6MJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jrnA (A:)
    gamdkrtqpttgtsggyyfsfwtdtpnsvtytngnggqfsmqwsgngnhvggkgwmpgts
    rtikysgsynpngnsylavygwtrnplieyyivenfgtynpssggqkkgevnvdgsvydi
    yvstrvnapsidgnktfqqywsvrrnkrssgsvntgahfqawknvglnlgthdyqilave
    gyyssgsasmtvsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jrnA (A:)
    rtqpttgtsggyyfsfwtdtpnsvtytngnggqfsmqwsgngnhvggkgwmpgtsrtiky
    sgsynpngnsylavygwtrnplieyyivenfgtynpssggqkkgevnvdgsvydiyvstr
    vnapsidgnktfqqywsvrrnkrssgsvntgahfqawknvglnlgthdyqilavegyyss
    gsasmtvsq