PDB entry 5jra

View 5jra on RCSB PDB site
Description: Nitric oxide complex of the L16V mutant of cytochrome c prime from Alcaligenes xylosoxidans
Class: electron transport
Keywords: gas sensor cytochrome nitric oxide, electron transport
Deposited on 2016-05-06, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c'
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00138 (1-125)
      • expression tag (0)
      • conflict (15)
    Domains in SCOPe 2.07: d5jraa1, d5jraa2
  • Heterogens: HEC, ASC, SO4, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jraA (A:)
    efakpedavkyrqsavtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
    pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
    dayrkk