PDB entry 5jr8

View 5jr8 on RCSB PDB site
Description: Disposal of Iron by a Mutant form of Siderocalin NGAL
Class: Siderophore binding protein
Keywords: Fe-Siderophore binding protein mutant, Siderophore binding protein
Deposited on 2016-05-05, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (Start-177)
      • conflict (14)
      • conflict (45)
      • conflict (73-74)
      • conflict (97)
      • conflict (117)
      • conflict (129)
      • conflict (148)
      • conflict (164)
    Domains in SCOPe 2.07: d5jr8a_
  • Chain 'B':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • conflict (14)
      • conflict (45)
      • conflict (72-74)
      • conflict (97)
      • conflict (117)
      • conflict (129)
      • conflict (148)
      • conflict (164)
    Domains in SCOPe 2.07: d5jr8b_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jr8A (A:)
    qdstsdlipapplssvplqqnfqdnqfqgkwyvvglagnailrededpqkmyatiyelke
    dksynvtsvlfrddgcdywirtfvpgcqpgeftlgniqsypgltsylvrvvstnynqfam
    vffkkvsqnqeyfkitlygrtkeltselqenfirfskslglpennivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jr8A (A:)
    dlipapplssvplqqnfqdnqfqgkwyvvglagnailrededpqkmyatiyelkedksyn
    vtsvlfrdgcdywirtfvpgcqpgeftlgniqsypgltsylvrvvstnynqfamvffkkv
    sqnqeyfkitlygrtkeltselqenfirfskslglpennivfpvpidqcidg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jr8B (B:)
    qdstsdlipapplssvplqqnfqdnqfqgkwyvvglagnailrededpqkmyatiyelke
    dksynvtsvlfrddgcdywirtfvpgcqpgeftlgniqsypgltsylvrvvstnynqfam
    vffkkvsqnqeyfkitlygrtkeltselqenfirfskslglpennivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jr8B (B:)
    sdlipapplssvplqqnfqdnqfqgkwyvvglagnailrededpqkmyatiyelkedksy
    nvtsvlfrddgcdywirtfvpgcqpgeftlgniqsypgltsylvrvvstnynqfamvffk
    kvsqnqeyfkitlygrtkeltselqenfirfskslglpennivfpvpidqcid