PDB entry 5jr0

View 5jr0 on RCSB PDB site
Description: domain 4 segment 6 of voltage-gated sodium channel nav1.4
Deposited on 2016-05-05, released 2017-05-17
The last revision was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium channel protein type 4 subunit alpha
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15390 (3-30)
      • expression tag (0-2)
      • expression tag (31-33)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jr0A (A:)
    kkkgicffcsyiiisflivvnmyiaiilenfkkk