PDB entry 5jqm

View 5jqm on RCSB PDB site
Description: crystal structure of phosphatidic acid transporter ups1/mdm35 void of bound phospholipid from saccharomyces cerevisiae at 1.5 angstroms resolution
Deposited on 2016-05-05, released 2017-07-12
The last revision was dated 2020-09-02, with a file datestamp of 2020-08-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein UPS1, mitochondrial,Mitochondrial distribution and morphology protein 35
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM35, YKL053C-A
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein UPS1, mitochondrial,Mitochondrial distribution and morphology protein 35
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM35, YKL053C-A
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein UPS1, mitochondrial,Mitochondrial distribution and morphology protein 35
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM35, YKL053C-A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jqmA (A:)
    mgsshhhhhhsqdpmvllhksthifptdfasvsraffnrypnpysphvlsidtisrnvdq
    egnlrttrllkksgklptwvkpflrgitetwiievsvvnpanstmktytrnldhtgimkv
    eeyttyqfdsatsstiadsrvkfssgfnmgikskvedwsrtkfdenvkksrmgmafviqk
    leearnpqflevlfqgpmgnimsasfapectdlktkydscfnewysekflkgksvenecs
    kqwyayttcvnaalvkqgikpaldeareeapfenggklkevdk
    

    Sequence, based on observed residues (ATOM records):
    >5jqmA (A:)
    mvllhksthifptdfasvsraffnrypnpysphvlsidtisrnvdqegnlrttrllkksg
    klptwvkpflrgitetwiievsvvnpanstmktytrnldhtgimkveeyttyqfdsatss
    tiadsrvkfssggikskvedwsrtkfdenvkksrmgmafviqkleeaimsasfapectdl
    ktkydscfnewysekflkgkscskqwyayttcvnaalvkqgikpaldeareeapf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jqmB (B:)
    mgsshhhhhhsqdpmvllhksthifptdfasvsraffnrypnpysphvlsidtisrnvdq
    egnlrttrllkksgklptwvkpflrgitetwiievsvvnpanstmktytrnldhtgimkv
    eeyttyqfdsatsstiadsrvkfssgfnmgikskvedwsrtkfdenvkksrmgmafviqk
    leearnpqflevlfqgpmgnimsasfapectdlktkydscfnewysekflkgksvenecs
    kqwyayttcvnaalvkqgikpaldeareeapfenggklkevdk
    

    Sequence, based on observed residues (ATOM records):
    >5jqmB (B:)
    mvllhksthifptdfasvsraffnrypnpysphvlsidtisrnvdqegnlrttrllkksg
    klptwvkpflrgitetwiievsvvnpanstmktytrnldhtgimkveeyttyqfdsatss
    tiadsrvkfssgfnmgikskvedwsrtkfdenvkksrmgmafviqklesasfapectdlk
    tkydscfnewysekflkgkecskqwyayttcvnaalvkqgikpaldeareeapfe
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jqmC (C:)
    mgsshhhhhhsqdpmvllhksthifptdfasvsraffnrypnpysphvlsidtisrnvdq
    egnlrttrllkksgklptwvkpflrgitetwiievsvvnpanstmktytrnldhtgimkv
    eeyttyqfdsatsstiadsrvkfssgfnmgikskvedwsrtkfdenvkksrmgmafviqk
    leearnpqflevlfqgpmgnimsasfapectdlktkydscfnewysekflkgksvenecs
    kqwyayttcvnaalvkqgikpaldeareeapfenggklkevdk
    

    Sequence, based on observed residues (ATOM records):
    >5jqmC (C:)
    mvllhksthifptdfasvsraffnrypnpysphvlsidtisrnvdqegnlrttrllkksg
    klptwvkpflrgitetwiievsvvnpanstmktytrnldhtgimkveeyttyqfdsatss
    tiadsrvkfssikskvedwsrtkfdenvkksrmgmafviqkleeimsasfapectdlktk
    ydscfnewysekflkgksvenecskqwyayttcvnaalvkqgikpaldeareeapf