PDB entry 5jqb

View 5jqb on RCSB PDB site
Description: crystal structure of ebola glycoprotein in complex with ibuprofen
Deposited on 2016-05-04, released 2016-06-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein 1,Envelope glycoprotein 1,Envelope glycoprotein 1
    Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05320 (4-End)
      • engineered mutation (14)
    • Uniprot Q05320
    • PDB 5JQB (323-329)
  • Chain 'B':
    Compound: Envelope glycoprotein 2
    Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, GOL, IBP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jqbA (A:)
    etgrsiplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwg
    frsgvppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpc
    agdfafhkegafflydrlastviyrgttfaegvvaflilpqakkdffsshplrepvnate
    dpssgyysttiryqatgfgtneteylfevdnltyvqlesrftpqfllqlnetiytsgkrs
    nttgkliwkvnpeidttigewafwetkknltrkirseelsftvvsthhqdtgeesassgk
    lglitntiagvaglitggrrtrrxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >5jqbA (A:)
    siplgvihnsalqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwgfrsg
    vppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpcagdf
    afhkegafflydrlastviyrgttfaegvvaflilpqakkdffsgyysttiryqatgfgt
    neteylfevdnltyvqlesrftpqfllqlnetiytsgkrsnttgkliwkvnpeidttewa
    fwetlsftvvxxxxxxx
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jqbB (B:)
    eaivnaqpkcnpnlhywttqdegaaiglawipyfgpaaegiyieglmhnqdglicglrql
    anettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcciephdwtknitd
    kidqiihdfvdgsgyipeaprdgqayvrkdgewvllstflgthhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jqbB (B:)
    eaivnaqpkcnpnlhywttqdegaaiglawipyfgpaaegiyieglmhnqdglicglrql
    anettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcciephdwtknitd
    kidqiihdfvd