PDB entry 5jq9

View 5jq9 on RCSB PDB site
Description: Yersinia pestis DHPS with pterine-sulfa conjugate Compound 16
Class: transferase/transferase inhibitor
Keywords: dihydropteroate synthesis, antibiotic, pterine-sulfa conjugates, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-05-04, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Yersinia pestis KIM D27 [TaxId:687916]
    Gene: folP, YPD27_2690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jq9a_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Yersinia pestis KIM D27 [TaxId:687916]
    Gene: folP, YPD27_2690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jq9b1, d5jq9b2
  • Heterogens: 6MB, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jq9A (A:)
    gsmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidig
    gestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindir
    slqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagia
    knkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvig
    svacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jq9A (A:)
    mhltargltldlsrpqvmgilnvtpnldqalqhaqrmlsagatlidiggestraaevseq
    eeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirslqepgaleaaakt
    glpvclmhmqqhspyyddlmtdinrffqhhiercvaagiaknkllldpgfgfgknlahny
    qllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsvacaviaamqgaqiirvhd
    vketveamciveatrsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jq9B (B:)
    gsmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidig
    gestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindir
    slqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagia
    knkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvig
    svacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jq9B (B:)
    smhltargltldlsrpqvmgilnvtnldqalqhaqrmlsagatlidiggestevseqeel
    drvvpvvealaqrfdvwlsvdtskaavitesahagahlindirslqepgaleaaaktglp
    vclmhmqpyyddlmtdinrffqhhiercvaagiaknkllldpgfgfgknlahnyqllahl
    selhhfelpllvgmsrksmvgqllnvppqqrvigsvacaviaamqgaqiirvhdvketve
    amciveatrsak