PDB entry 5jpw

View 5jpw on RCSB PDB site
Description: molecular basis for protein recognition specificity of the dynlt1/tctex1 canonical binding groove. characterization of the interaction with activin receptor iib
Deposited on 2016-05-04, released 2016-08-17
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain Tctex-type 1,Cytoplasmic dynein 1 intermediate chain 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Dync1i2, Dnci2, Dncic2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63172
      • expression tag (0-1)
      • linker (115-121)
    • Uniprot Q13409
  • Chain 'B':
    Compound: Dynein light chain Tctex-type 1,Cytoplasmic dynein 1 intermediate chain 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Dync1i2, Dnci2, Dncic2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63172 (2-114)
      • expression tag (0-1)
      • linker (115-121)
    • Uniprot Q13409 (122-142)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jpwA (A:)
    gsmedyqaaeetafvvdevsnivkeaiesaiggnayqhskvnqwttnvveqtlsqltklg
    kpfkyivtcvimqkngaglhtasscfwdsstdgsctvrwenktmycivsafglsigggsg
    qsgpiklgmakitqvdfppreiv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5jpwB (B:)
    gsmedyqaaeetafvvdevsnivkeaiesaiggnayqhskvnqwttnvveqtlsqltklg
    kpfkyivtcvimqkngaglhtasscfwdsstdgsctvrwenktmycivsafglsigggsg
    qsgpiklgmakitqvdfppreiv