PDB entry 5jpu

View 5jpu on RCSB PDB site
Description: Structure of limonene epoxide hydrolase mutant - H-2-H5 complex with (S,S)-cyclohexane-1,2-diol
Class: hydrolase
Keywords: Epoxide Hydrolase, Enantioselectivity, Complex, HYDROLASE
Deposited on 2016-05-04, released 2016-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: limonene epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JPU
    Domains in SCOPe 2.08: d5jpua_
  • Chain 'B':
    Compound: limonene epoxide hydrolase
    Species: Rhodococcus erythropolis [TaxId:1833]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JPU
    Domains in SCOPe 2.08: d5jpub_
  • Heterogens: 3ZQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jpuA (A:)
    mhhhhhhtskieqprwaskddaagkastpdekivlefmdaltsndaaklidyfaedtmyq
    nmplppaygrdaveqtlagffkvfsidavetfhigstkglvytervdvlralptgksynv
    svlgvfqltegkitgwrdyfdlreveeavdlpfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jpuA (A:)
    stpdekivlefmdaltsndaaklidyfaedtmyqnmplppaygrdaveqtlagffkvfsi
    davetfhigstkglvytervdvlralptgksynvsvlgvfqltegkitgwrdyfdlre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jpuB (B:)
    mhhhhhhtskieqprwaskddaagkastpdekivlefmdaltsndaaklidyfaedtmyq
    nmplppaygrdaveqtlagffkvfsidavetfhigstkglvytervdvlralptgksynv
    svlgvfqltegkitgwrdyfdlreveeavdlpfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jpuB (B:)
    stpdekivlefmdaltsndaaklidyfaedtmyqnmplppaygrdaveqtlagffkvfsi
    davetfhigstkglvytervdvlralptgksynvsvlgvfqltegkitgwrdyfdlre