PDB entry 5jpo

View 5jpo on RCSB PDB site
Description: complex structure of human elongation factor 1b gamma gst-liked domain and delta n-terminal domain
Deposited on 2016-05-04, released 2017-05-10
The last revision was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: EEF1G, EF1G, PRO1608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26641 (2-End)
      • expression tag (1)
  • Chain 'B':
    Compound: Elongation factor 1-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: EEF1G, EF1G, PRO1608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26641 (2-End)
      • expression tag (1)
  • Chain 'C':
    Compound: Elongation factor 1-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: EEF1G, EF1G, PRO1608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26641 (2-End)
      • expression tag (1)
  • Chain 'D':
    Compound: Elongation factor 1-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: EEF1G, EF1G, PRO1608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26641 (2-End)
      • expression tag (0-1)
  • Chain 'E':
    Compound: Elongation factor 1-delta
    Species: Homo sapiens [TaxId:9606]
    Gene: EEF1D, EF1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29692 (2-31)
      • expression tag (0-1)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jpoA (A:)
    gamaagtlytypenwrafkaliaaqysgaqvrvlsapphfhfgqtnrtpeflrkfpagkv
    pafegddgfcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptl
    gimhhnkqatenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvlep
    sfrqafpntnrwfltcinqpqfravlgevklcekmaqfda
    

    Sequence, based on observed residues (ATOM records):
    >5jpoA (A:)
    amaagtlytypenwrafkaliaaqysgaqvrvlsapphfhfgqtnrtpeflrkfpagkvp
    afegddgfcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptlg
    imhhnkqatenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvleps
    frqafpntnrwfltcinqpqfravlgevklcekmaq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jpoB (B:)
    gamaagtlytypenwrafkaliaaqysgaqvrvlsapphfhfgqtnrtpeflrkfpagkv
    pafegddgfcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptl
    gimhhnkqatenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvlep
    sfrqafpntnrwfltcinqpqfravlgevklcekmaqfda
    

    Sequence, based on observed residues (ATOM records):
    >5jpoB (B:)
    amaagtlytypenwrafkaliaaqysgaqvrvlsapphfhfgqtnrtpeflrkfpagkvp
    afegddgfcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptlg
    imhhnkqatenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvleps
    frqafpntnrwfltcinqpqfravlgevklcekma
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jpoC (C:)
    gamaagtlytypenwrafkaliaaqysgaqvrvlsapphfhfgqtnrtpeflrkfpagkv
    pafegddgfcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptl
    gimhhnkqatenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvlep
    sfrqafpntnrwfltcinqpqfravlgevklcekmaqfda
    

    Sequence, based on observed residues (ATOM records):
    >5jpoC (C:)
    amaagtlytypenwrafkaliaaqysgaqvrvlsaqtnrtpeflrkfpagkvpafegddg
    fcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptlgimhhnkq
    atenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvlepsfrqafpn
    tnrwfltcinqpqfravlgevklcekma
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jpoD (D:)
    gamaagtlytypenwrafkaliaaqysgaqvrvlsapphfhfgqtnrtpeflrkfpagkv
    pafegddgfcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptl
    gimhhnkqatenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvlep
    sfrqafpntnrwfltcinqpqfravlgevklcekmaqfda
    

    Sequence, based on observed residues (ATOM records):
    >5jpoD (D:)
    gamaagtlytypenwrafkaliaaqysgaqvrvlsapphfhfgqtnrtpeflrkfpagkv
    pafegddgfcvfesnaiayyvsneelrgstpeaaaqvvqwvsfadsdivppastwvfptl
    gimhhnkqatenakeevrrilglldaylktrtflvgervtladitvvctllwlykqvlep
    sfrqafpntnrwfltcinqpqfravlgevklcekm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5jpoE (E:)
    gamatnflahekiwfdkfkyddaerrfyeqmn