PDB entry 5joz

View 5joz on RCSB PDB site
Description: Bacteroides ovatus Xyloglucan PUL GH43B
Class: hydrolase
Keywords: Glycoside hydrolase, GH43, hydrolase
Deposited on 2016-05-03, released 2016-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-reducing end alpha-L-arabinofuranosidase BoGH43B
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: BACOVA_02656
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LXU0 (Start-506)
      • expression tag (507-508)
    Domains in SCOPe 2.06: d5joza1, d5joza2, d5joza3
  • Chain 'B':
    Compound: Non-reducing end alpha-L-arabinofuranosidase BoGH43B
    Species: BACTEROIDES OVATUS [TaxId:28116]
    Gene: BACOVA_02656
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jozb1, d5jozb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jozA (A:)
    mqktfrnpiitgmnpdpsicrvgddfylvtstfeyfpglpvyhskdlvhwklighalsrp
    ennplmgcnastggqyaptlryhdgtfyvigtnyggkgsqgvfyvtaknpagpwsdpvwv
    gnwyvdpsiefidgkmyflspdnqgsfllgvmdpetgtfvealrkvasglggsspegphf
    ykigdyyyimsaeggtgyehreviqrskspwgpyepspvnpvlsnmncpdhpfqaighad
    lvqlkdgswwavclgirpvngkyqhlgretflapvtwdadgwpkvgkdgvvqetylfpnl
    pshvwmeqpvrddfdqetlgldwtfirnpahsfwsltekpgslrlkgtainfttndspsf
    igrrqaafnltasakvnfipkveneeaglvvraddknhydlliterngqrvamirktlkd
    kvvdttckelpatgevilsitatettytfeikaahvsailgtastrdvsnevvggftgvf
    igmyasgngqantnpadfdwfdfrcldlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jozA (A:)
    ktfrnpiitgmnpdpsicrvgddfylvtstfeyfpglpvyhskdlvhwklighalsrpen
    nplmgcnastggqyaptlryhdgtfyvigtnyggkgsqgvfyvtaknpagpwsdpvwvgn
    wyvdpsiefidgkmyflspdnqgsfllgvmdpetgtfvealrkvasglggsspegphfyk
    igdyyyimsaeggtgyehreviqrskspwgpyepspvnpvlsnmncpdhpfqaighadlv
    qlkdgswwavclgirpvngkyqhlgretflapvtwdadgwpkvgkdgvvqetylfpnlps
    hvwmeqpvrddfdqetlgldwtfirnpahsfwsltekpgslrlkgtainfttndspsfig
    rrqaafnltasakvnfipkveneeaglvvraddknhydlliterngqrvamirktlkdkv
    vdttckelpatgevilsitatettytfeikaahvsailgtastrdvsnevvggftgvfig
    myasgngqantnpadfdwfdfrcldle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jozB (B:)
    mqktfrnpiitgmnpdpsicrvgddfylvtstfeyfpglpvyhskdlvhwklighalsrp
    ennplmgcnastggqyaptlryhdgtfyvigtnyggkgsqgvfyvtaknpagpwsdpvwv
    gnwyvdpsiefidgkmyflspdnqgsfllgvmdpetgtfvealrkvasglggsspegphf
    ykigdyyyimsaeggtgyehreviqrskspwgpyepspvnpvlsnmncpdhpfqaighad
    lvqlkdgswwavclgirpvngkyqhlgretflapvtwdadgwpkvgkdgvvqetylfpnl
    pshvwmeqpvrddfdqetlgldwtfirnpahsfwsltekpgslrlkgtainfttndspsf
    igrrqaafnltasakvnfipkveneeaglvvraddknhydlliterngqrvamirktlkd
    kvvdttckelpatgevilsitatettytfeikaahvsailgtastrdvsnevvggftgvf
    igmyasgngqantnpadfdwfdfrcldlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jozB (B:)
    ktfrnpiitgmnpdpsicrvgddfylvtstfeyfpglpvyhskdlvhwklighalsrpen
    nplmgcnastggqyaptlryhdgtfyvigtnyggkgsqgvfyvtaknpagpwsdpvwvgn
    wyvdpsiefidgkmyflspdnqgsfllgvmdpetgtfvealrkvasglggsspegphfyk
    igdyyyimsaeggtgyehreviqrskspwgpyepspvnpvlsnmncpdhpfqaighadlv
    qlkdgswwavclgirpvngkyqhlgretflapvtwdadgwpkvgkdgvvqetylfpnlps
    hvwmeqpvrddfdqetlgldwtfirnpahsfwsltekpgslrlkgtainfttndspsfig
    rrqaafnltasakvnfipkveneeaglvvraddknhydlliterngqrvamirktlkdkv
    vdttckelpatgevilsitatettytfeikaahvsailgtastrdvsnevvggftgvfig
    myasgngqantnpadfdwfdfrcl