PDB entry 5jop

View 5jop on RCSB PDB site
Description: Crystal structure of anti-glycan antibody Fab14.22 in complex with Streptococcus pneumoniae serotype 14 tetrasaccharide at 1.75 A
Class: immune system
Keywords: S. pneumoniae serotype 14, anti-glycan B cells, synthetic conjugate vaccine, nanomolar affinity anti-glycan antibody, immune system, immune system-bacterial glycan complex
Deposited on 2016-05-02, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Fab 14.22 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JOP (0-End)
    Domains in SCOPe 2.07: d5jopd1, d5jopd2
  • Chain 'E':
    Compound: Fab14.22 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JOP (0-End)
  • Chain 'H':
    Compound: Fab14.22 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JOP (0-End)
  • Chain 'L':
    Compound: Fab 14.22 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JOP (0-End)
    Domains in SCOPe 2.07: d5jopl1, d5jopl2
  • Heterogens: GAL, BGC, NAG, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jopD (D:)
    dvlltqtplslpvnlgdqasiscrssqtilhsdgytylewylqrpgqspklliyrvykrf
    sgipdrfrgsgsgmdftltisgveaedlgiyycfqgsyvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jopD (D:)
    dvlltqtplslpvnlgdqasiscrssqtilhsdgytylewylqrpgqspklliyrvykrf
    sgipdrfrgsgsgmdftltisgveaedlgiyycfqgsyvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5jopL (L:)
    dvlltqtplslpvnlgdqasiscrssqtilhsdgytylewylqrpgqspklliyrvykrf
    sgipdrfrgsgsgmdftltisgveaedlgiyycfqgsyvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jopL (L:)
    dvlltqtplslpvnlgdqasiscrssqtilhsdgytylewylqrpgqspklliyrvykrf
    sgipdrfrgsgsgmdftltisgveaedlgiyycfqgsyvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne