PDB entry 5jon

View 5jon on RCSB PDB site
Description: crystal structure of the unliganded form of hcn2 cnbd
Deposited on 2016-05-02, released 2016-11-30
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein,Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Hcn2, Bcng2, Hac1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (Start-366)
      • linker (367-369)
    • Uniprot O88703 (370-End)
  • Chain 'B':
    Compound: Maltose-binding periplasmic protein,Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Hcn2, Bcng2, Hac1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (1-366)
      • linker (367-369)
    • Uniprot O88703 (370-End)
  • Heterogens: NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jonA (A:)
    gkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
    alkdaqtnaaelngplreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdy
    iiregtigkkmyfiqhgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrl
    yslsvdnfnevleeypmmrrafetvaidrldrigkkn
    

    Sequence, based on observed residues (ATOM records):
    >5jonA (A:)
    ieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiif
    wahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdl
    lpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdv
    gvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvn
    ygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplga
    valksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdeal
    kdaqtnaaelngplreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyii
    regtigkkmyfiqhgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlys
    lsvdnfnevleeypmmrrafetvaidrld
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jonB (B:)
    gkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
    alkdaqtnaaelngplreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdy
    iiregtigkkmyfiqhgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrl
    yslsvdnfnevleeypmmrrafetvaidrldrigkkn
    

    Sequence, based on observed residues (ATOM records):
    >5jonB (B:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtnaaelngplreeivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyi
    iregtigkkmyfiqhgvvsvltkgnkemklsdgsyfgeiclltrgrrtasvradtycrly
    slsvdnfnevleeypmmrrafetvai