PDB entry 5jom

View 5jom on RCSB PDB site
Description: X-ray structure of CO-bound sperm whale myoglobin using a fixed target crystallography chip
Class: oxygen storage
Keywords: fixed target crystallography chip, CO-bound sperm whale myoglobin, XFEL, OXYGEN STORAGE
Deposited on 2016-05-02, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • conflict (122)
  Domains in SCOPe 2.07: d5joma_
• Heterogens: HEM, SO4, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jomA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg