PDB entry 5jom

View 5jom on RCSB PDB site
Description: X-ray structure of CO-bound sperm whale myoglobin using a fixed target crystallography chip
Class: oxygen storage
Keywords: fixed target crystallography chip, CO-bound sperm whale myoglobin, XFEL, OXYGEN STORAGE
Deposited on 2016-05-02, released 2016-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • conflict (122)
    Domains in SCOPe 2.06: d5joma_
  • Heterogens: HEM, SO4, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jomA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg