PDB entry 5joj

View 5joj on RCSB PDB site
Description: Calcium-loaded EF-hand domain of L-plastin
Class: metal binding protein
Keywords: Calcium-binding, EF-hand, L-plastin, METAL BINDING PROTEIN
Deposited on 2016-05-02, released 2017-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plastin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LCP1, PLS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5joja_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jojA (A:)
margsvsdeemmelreafakvdtdgngyisfnelndlfkaaclplpgyrvreitenlmat
gdldqdgrisfdefikifhglkstdvaktfrkainkk