PDB entry 5jo8

View 5jo8 on RCSB PDB site
Description: cep104 tog domain
Deposited on 2016-05-02, released 2016-07-20
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cep104
    Species: Gallus gallus [TaxId:9031]
    Gene: CEP104
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jo8A (A:)
    mgsshhhhhhssglvprgshmepeplsekalreaspaievfgealvsgayskswsyreda
    llavykklmemsvstpkedlrnmlraaiflvrraikdivssvfqaslkllkmiitqyvpk
    hklgkletshcvektlpgllsrtgdsssrlrivaakfiqemalwsevkplqivpvhlvql
    lkpnspthlamsrvelvecllkemgtensgftisnvmkfatgalehrvyevrdvalriif
    gmyrkhkaaileylppddasirktvlyktlfdgftkidg
    

    Sequence, based on observed residues (ATOM records):
    >5jo8A (A:)
    epeplsekalreaspaievfgealvsgayskswsyredallavykklmemsvstpkedlr
    nmlraaiflvrraikdivssvfqaslkllkmiitqyvpkhklgkletshcvektlpglls
    rtgdsssrlrivaakfiqemalwsevkplqivpvhlvqllkpnspthlamsrvelvecll
    kemgtensgftisnvmkfatgalehrvyevrdvalriifgmyrkhkaaileylppddasi
    rktvlyktlfdgftki