PDB entry 5jnw

View 5jnw on RCSB PDB site
Description: Crystal structure of bovine low molecular weight protein tyrosine phosphatase (LMPTP) mutant (W49Y N50E) complexed with vanadate and uncompetitive inhibitor
Class: hydrolase/hydrolase INHIBITOR
Keywords: protein tyrosine phosphatase, hydrolase, LMW-PTP, LMPTP, hydrolase-hydrolase INHIBITOR complex
Deposited on 2016-04-30, released 2017-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Bos taurus [TaxId:9913]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11064 (Start-158)
      • conflict (50-51)
    Domains in SCOPe 2.06: d5jnwa_
  • Heterogens: VO4, 6LJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jnwA (A:)
    gsaeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdyevgrspdpr
    avsclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgs
    ydpqkqliiedpyygndadfetvyqqcvrccraflekvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jnwA (A:)
    vtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdyevgrspdpravscl
    rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
    qliiedpyygndadfetvyqqcvrccraflekvr