PDB entry 5jnu

View 5jnu on RCSB PDB site
Description: Crystal structure of mouse Low-Molecular Weight Protein Tyrosine Phosphatase type A (LMPTP-A) complexed with phosphate
Class: hydrolase
Keywords: protein tyrosine phosphatase, hydrolase, LMW-PTP, LMPTP
Deposited on 2016-04-30, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jnua_
  • Chain 'B':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jnub_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jnuA (A:)
    gsmaevgsksvlfvclgnicrspiaeavfrklvtdekvsdnwridsaatstyevgnppdy
    rgqncmrkhgihmqhiarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellg
    sydpqkqliiedpyygndsdfevvyqqclrcckaflekty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jnuA (A:)
    gsksvlfvclgnicrspiaeavfrklvtdekvsdnwridsaatstyevgnppdyrgqncm
    rkhgihmqhiarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqk
    qliiedpyygndsdfevvyqqclrcckaflekt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jnuB (B:)
    gsmaevgsksvlfvclgnicrspiaeavfrklvtdekvsdnwridsaatstyevgnppdy
    rgqncmrkhgihmqhiarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellg
    sydpqkqliiedpyygndsdfevvyqqclrcckaflekty
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jnuB (B:)
    gsksvlfvclgnicrspiaeavfrklvtdekvsdnwridsaatstyevgnppdyrgqncm
    rkhgihmqhiarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqk
    qliiedpyygndsdfevvyqqclrcckaflekt