PDB entry 5jnt

View 5jnt on RCSB PDB site
Description: Crystal structure of human low molecular weight protein tyrosine phosphatase (LMPTP) type A complexed with MES
Class: hydrolase
Keywords: protein tyrosine phosphatase, hydrolase, LMW-PTP, LMPTP
Deposited on 2016-04-30, released 2017-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24666 (Start-159)
      • conflict (6)
    Domains in SCOPe 2.08: d5jnta_
  • Heterogens: MES, DMS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5jntA (A:)
gsmaeqvtksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdy
rgqscmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellg
sydpqkqliiedpyygndsdfetvyqqcvrccraflekah

    Sequence, based on observed residues (ATOM records): (download) 
    >5jntA (A:)
vtksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
qliiedpyygndsdfetvyqqcvrccraflekah