PDB entry 5jns

View 5jns on RCSB PDB site
Description: Crystal structure of human low molecular weight protein tyrosine phosphatase (LMPTP) type A complexed with phosphate
Class: hydrolase
Keywords: protein tyrosine phosphatase, hydrolase, LMW-PTP, LMPTP
Deposited on 2016-04-30, released 2017-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jnsa_
  • Heterogens: PO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5jnsA (A:)
gsmaeqatksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdy
rgqscmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellg
sydpqkqliiedpyygndsdfetvyqqcvrccraflekah

    Sequence, based on observed residues (ATOM records): (download) 
    >5jnsA (A:)
tksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscmk
rhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqkq
liiedpyygndsdfetvyqqcvrccrafleka