PDB entry 5jnm

View 5jnm on RCSB PDB site
Description: crystal structure of mtld from staphylococcus aureus at 1.7-angstrom resolution
Deposited on 2016-04-30, released 2017-11-08
The last revision was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannitol-1-phosphate 5-dehydrogenase
    Species: Staphylococcus aureus (strain Mu3 / ATCC 700698) [TaxId:418127]
    Gene: mtlD, SAHV_2143
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7X522 (34-401)
      • expression tag (25-33)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jnmA (A:)
    mgsshhhhhhssglvprgshmasgttenlyfqgsmkavhfgagnigrgfigyiladnnvk
    vtfadvneeiinalahdhqydviladesktttrvnnvdainsmqpsealkqaileadiit
    tavgvnilpiiaksfapflkektnhvnivacenaimatdtlkkavlditgplgnnihfan
    savdrivplqknenildvmvepfyewvvekdawygpelnhikyvddltpyierklltvnt
    ghaylayagkfagkatvldavkdssieaglrrvlaetsqyitnefdfteaeqagyvekii
    drfnnsylsdevtrvgrgtlrkigpkdriikpltylynkdlertgllntaalllkyddta
    dqetveknnyikehglkaflseyakvddgladeiieaynsls
    

    Sequence, based on observed residues (ATOM records):
    >5jnmA (A:)
    tenlyfqgsmkavhfgagnigrgfigyiladnnvkvtfadvneeiinalahdhqydvila
    desktttrvnnvdainsmqpsealkqaileadiittavgvnilpiiaksfapflkektnh
    vnivacenaimatdtlkkavlditgplgnnihfansavdrivplqknenildvmvepfye
    wvvekdawygpelnhikyvddltpyierklltvntghaylayagkfagkatvldavkdss
    ieaglrrvlaetsqyitnefdfteaeqagyvekiidrfnnsylsdevtrvgrgtlrkigp
    kdriikpltylynkdlertgllntaalllkyddtadqetveknnyikehglkaflseyak
    vddgladeiieaynsls