PDB entry 5jnl

View 5jnl on RCSB PDB site
Description: structure of plasmodium falciparum dxr in complex with a beta- substituted fosmidomycin analogue, lc54 and manganese
Deposited on 2016-04-30, released 2016-08-24
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, apicoplastic
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: DXR, PF14_0641
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, apicoplastic
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: DXR, PF14_0641
    Database cross-references and differences (RAF-indexed):
  • Heterogens: L54, MN, GOL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jnlA (A:)
    mahhhhhhkkpinvaifgstgsigtnalniirecnkienvfnvkalyvnksvnelyeqar
    eflpeylcihdksvyeelkelvknikdykpiilcgdegmkeicssnsidkivigidsfqg
    lystmyaimnnkivalankesivsagfflkkllnihknakiipvdsehsaifqcldnnkv
    lktkclqdnfskinninkiflcssggpfqnltmdelknvtsenalkhpkwkmgkkitids
    atmmnkgleviethflfdvdyndievivhkeciihscvefidksvisqmyypdmqipily
    sltwpdriktnlkpldlaqvstltfhkpslehfpciklayqagikgnfyptvlnasneia
    nnlflnnkikyfdissiisqvlesfnsqkvsensedlmkqilqihswakdkatdiynkhn
    ss
    

    Sequence, based on observed residues (ATOM records):
    >5jnlA (A:)
    pinvaifgstgsigtnalniirecnkienvfnvkalyvnksvnelyeqareflpeylcih
    dksvyeelkelvknikdykpiilcgdegmkeicssnsidkivigidsfqglystmyaimn
    nkivalankesivsagfflkkllnihknakiipvdsehsaifqcldnnkvlktkclqdnf
    skinninkiflcssggpfqnltmdelknvtsenalkhpkwkmgkkitidsatmmnkglev
    iethflfdvdyndievivhkeciihscvefidksvisqmyypdmqipilysltwpdrikt
    nlkpldlaqvstltfhkpslehfpciklayqagikgnfyptvlnasneiannlflnnkik
    yfdissiisqvlesfnsqkvsensedlmkqilqihswakdkatdiynkhn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jnlB (B:)
    mahhhhhhkkpinvaifgstgsigtnalniirecnkienvfnvkalyvnksvnelyeqar
    eflpeylcihdksvyeelkelvknikdykpiilcgdegmkeicssnsidkivigidsfqg
    lystmyaimnnkivalankesivsagfflkkllnihknakiipvdsehsaifqcldnnkv
    lktkclqdnfskinninkiflcssggpfqnltmdelknvtsenalkhpkwkmgkkitids
    atmmnkgleviethflfdvdyndievivhkeciihscvefidksvisqmyypdmqipily
    sltwpdriktnlkpldlaqvstltfhkpslehfpciklayqagikgnfyptvlnasneia
    nnlflnnkikyfdissiisqvlesfnsqkvsensedlmkqilqihswakdkatdiynkhn
    ss
    

    Sequence, based on observed residues (ATOM records):
    >5jnlB (B:)
    pinvaifgstgsigtnalniirecnkienvfnvkalyvnksvnelyeqareflpeylcih
    dksvyeelkelvknikdykpiilcgdegmkeicssnsidkivigidsfqglystmyaimn
    nkivalankesivsagfflkkllnihknakiipvdsehsaifqcldnnkvlktkclqdnf
    skinninkiflcssggpfqnltmdelknvtsenalkhpkwkmgkkitidsatmmnkglev
    iethflfdvdyndievivhkeciihscvefidksvisqmyypdmqipilysltwpdrikt
    nlkpldlaqvstltfhkpslehfpciklayqagikgnfyptvlnasneiannlflnnkik
    yfdissiisqvlesfnsqkvsensedlmkqilqihswakdkatdiynkhn