PDB entry 5jnf

View 5jnf on RCSB PDB site
Description: crystal structure of the lgra initiation module excluding the asub domain: f-a-delta-sub
Deposited on 2016-04-29, released 2016-10-12
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Linear gramicidin synthase subunit A
    Species: Brevibacillus parabrevis [TaxId:54914]
    Gene: lgrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70LM7 (4-586)
      • expression tag (2-3)
  • Chain 'B':
    Compound: Linear gramicidin synthase subunit A
    Species: Brevibacillus parabrevis [TaxId:54914]
    Gene: lgrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70LM7 (4-586)
      • expression tag (2-3)
  • Chain 'C':
    Compound: Linear gramicidin synthase subunit A
    Species: Brevibacillus parabrevis [TaxId:54914]
    Gene: lgrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70LM7 (4-586)
      • expression tag (2-3)
  • Chain 'D':
    Compound: Linear gramicidin synthase subunit A
    Species: Brevibacillus parabrevis [TaxId:54914]
    Gene: lgrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70LM7 (4-586)
      • expression tag (2-3)
  • Heterogens: FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jnfA (A:)
    gamgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyild
    keivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeei
    afadedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnm
    ttvrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlnera
    nqlahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymlad
    ssaailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytsgstgla
    kgvmiehhnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpse
    rkydldalndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtykly
    ngygptectimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgegl
    grgylnrpeltaekfivhpqtgermyrtgdrarflpdgnieflgrld
    

    Sequence, based on observed residues (ATOM records):
    >5jnfA (A:)
    mgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyildke
    ivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeeiaf
    adedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnmtt
    vrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlneranq
    lahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymladss
    aailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytsgstglakg
    vmiehhnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpserk
    ydldalndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtyklyng
    ygptectimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgeglgr
    gylnrpeltaekfivhpqtgermyrtgdrarflpdgnieflgrld
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jnfB (B:)
    gamgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyild
    keivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeei
    afadedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnm
    ttvrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlnera
    nqlahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymlad
    ssaailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytsgstgla
    kgvmiehhnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpse
    rkydldalndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtykly
    ngygptectimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgegl
    grgylnrpeltaekfivhpqtgermyrtgdrarflpdgnieflgrld
    

    Sequence, based on observed residues (ATOM records):
    >5jnfB (B:)
    mgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyildke
    ivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeeiaf
    adedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnmtt
    vrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlneranq
    lahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymladss
    aailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytlakgvmieh
    hnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpserkydlda
    lndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtyklyngygpte
    ctimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgeglgrgylnr
    peltaekfivhpqtgermyrtgdrarflpdgnieflgrld
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jnfC (C:)
    gamgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyild
    keivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeei
    afadedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnm
    ttvrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlnera
    nqlahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymlad
    ssaailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytsgstgla
    kgvmiehhnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpse
    rkydldalndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtykly
    ngygptectimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgegl
    grgylnrpeltaekfivhpqtgermyrtgdrarflpdgnieflgrld
    

    Sequence, based on observed residues (ATOM records):
    >5jnfC (C:)
    mgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyildke
    ivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeeiaf
    adedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnmtt
    vrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlneranq
    lahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymladss
    aailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytstglakgvm
    iehhnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpserkyd
    ldalndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtyklyngyg
    ptectimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgeglgrgy
    lnrpeltaekfivhpqtgermyrtgdrarflpdgnieflgrld
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jnfD (D:)
    gamgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyild
    keivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeei
    afadedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnm
    ttvrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlnera
    nqlahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymlad
    ssaailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytsgstgla
    kgvmiehhnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpse
    rkydldalndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtykly
    ngygptectimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgegl
    grgylnrpeltaekfivhpqtgermyrtgdrarflpdgnieflgrld
    

    Sequence, based on observed residues (ATOM records):
    >5jnfD (D:)
    mgrilflttfmskgnkvvryleslhhevvicqekvhaqsanlqeidwivsyaygyildke
    ivsrfrgriinlhpsllpwnkgrdpvfwsvwdetpkgvtihlidehvdtgdilvqeeiaf
    adedtlldcynkanqaieelfirewenivhgriapyrqtaggtlhfkadrdfyknlnmtt
    vrellalkrlcaepkrgekpidktfhqlfeqqvemtpdhvavvdrgqsltykqlneranq
    lahhlrgkgvkpddqvaimldksldmivsilavmkaggayvpidpdypgeriaymladss
    aailltnalheekangacdiidvhdpdsysentnnlphvnrpddlvyvmytsgakgvmie
    hhnlvnfcewyrpyfgvtpadkalvyssfsfdgsaldifthllagaalhivpserkydld
    alndycnqegitisylptgaaeqfmqmdnqsfrvvitggdvlkkierngtyklyngygpt
    ectimvtmfevdkpyanipigkpidrtrilildealalqpigvagelfivgeglgrgyln
    rpeltaekfivhpqtgermyrtgdrarflpdgnieflgrld