PDB entry 5jnb

View 5jnb on RCSB PDB site
Description: structure of gld-2/rnp-8 complex
Deposited on 2016-04-29, released 2016-06-22
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(A) RNA polymerase gld-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: gld-2, ZC308.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O17087 (2-End)
      • expression tag (0-1)
      • engineered mutation (124)
  • Chain 'B':
    Compound: Poly(A) RNA polymerase gld-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: gld-2, ZC308.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O17087 (2-End)
      • expression tag (0-1)
      • engineered mutation (124)
  • Chain 'C':
    Compound: Poly(A) RNA polymerase gld-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: gld-2, ZC308.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O17087 (2-End)
      • expression tag (0-1)
      • engineered mutation (124)
  • Chain 'D':
    Compound: Poly(A) RNA polymerase gld-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: gld-2, ZC308.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O17087
      • engineered mutation (124)
  • Chain 'E':
    Compound: RNP (RRM RNA binding domain) containing
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: rnp-8, CELE_R119.7, R119.7
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: RNP (RRM RNA binding domain) containing
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: rnp-8, CELE_R119.7, R119.7
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: RNP (RRM RNA binding domain) containing
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: rnp-8, CELE_R119.7, R119.7
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: RNP (RRM RNA binding domain) containing
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: rnp-8, CELE_R119.7, R119.7
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, MG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jnbA (A:)
    gamdvlsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnn
    ssdmdlclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfd
    ditvalnannsvairnthllcyyssydwrvrplvsvvkewakrkgindankssftsyslv
    lmvihflqcgptkvlpnlqqsypnrfsnkvdvrtlnvtmaleevaddidqslsekttlge
    lligfldyyanefnydrdaisirqgrrverasisnphfwrsqwrcvcieepftnsntahs
    iydemvfeaikkafreahgelqhnhdldklmecepika
    

    Sequence, based on observed residues (ATOM records):
    >5jnbA (A:)
    gamdvlsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnn
    ssdmdlclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfd
    ditvalnannsvairnthllcyyssydwrvrplvsvvkewakrkgindankssftsyslv
    lmvihflqcgptkvlpnlqqsypnrfsnkvdvrtlnvtmaleevaddidqslsekttlge
    lligfldyyanefnydrdaisirqgrrveraphfwrsqwrcvcieepftahsiydemvfe
    aikkafreahgelqhnhdldklmecepik
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jnbB (B:)
    gamdvlsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnn
    ssdmdlclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfd
    ditvalnannsvairnthllcyyssydwrvrplvsvvkewakrkgindankssftsyslv
    lmvihflqcgptkvlpnlqqsypnrfsnkvdvrtlnvtmaleevaddidqslsekttlge
    lligfldyyanefnydrdaisirqgrrverasisnphfwrsqwrcvcieepftnsntahs
    iydemvfeaikkafreahgelqhnhdldklmecepika
    

    Sequence, based on observed residues (ATOM records):
    >5jnbB (B:)
    gamdvlsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnn
    ssdmdlclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfd
    ditvalnannsvairnthllcyyssydwrvrplvsvvkewakrkgindankssftsyslv
    lmvihflqcgptkvlpnlqqsypnrfsnkvdvrtlnvtmaleedqslsekttlgelligf
    ldyyanefnydrdaisirqgrrverasphfwrsqwrcvcieepftahsiydemvfeaikk
    afreahgelqhnhdldklmecepi
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jnbC (C:)
    gamdvlsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnn
    ssdmdlclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfd
    ditvalnannsvairnthllcyyssydwrvrplvsvvkewakrkgindankssftsyslv
    lmvihflqcgptkvlpnlqqsypnrfsnkvdvrtlnvtmaleevaddidqslsekttlge
    lligfldyyanefnydrdaisirqgrrverasisnphfwrsqwrcvcieepftnsntahs
    iydemvfeaikkafreahgelqhnhdldklmecepika
    

    Sequence, based on observed residues (ATOM records):
    >5jnbC (C:)
    gamdvlsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnn
    ssdmdlclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfd
    ditvalnannsvairnthllcyyssydwrvrplvsvvkewakrkgiftsyslvlmvihfl
    qcgptkvlpnlqqsypnrfsnkvdvrtlnvtmaleslsekttlgelligfldyyanefny
    drdaisirqgrrverawrcvcieepfkkafreahgelqhnhdldklmec
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jnbD (D:)
    gamdvlsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnn
    ssdmdlclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfd
    ditvalnannsvairnthllcyyssydwrvrplvsvvkewakrkgindankssftsyslv
    lmvihflqcgptkvlpnlqqsypnrfsnkvdvrtlnvtmaleevaddidqslsekttlge
    lligfldyyanefnydrdaisirqgrrverasisnphfwrsqwrcvcieepftnsntahs
    iydemvfeaikkafreahgelqhnhdldklmecepika
    

    Sequence, based on observed residues (ATOM records):
    >5jnbD (D:)
    lsekiwdyhnkvsqtdemlqrklhlrdmlytaispvfplsglyvvgsslngfgnnssdmd
    lclmitnkdldqkndavvvlnlilstlqyekfvesqklilakvpilrinfaapfdditva
    lnannsvairnthllcyyssydwrvrplvsvvkewakrtsyslvlmvihflqcgptkvlp
    nlqqsypnrfsnkvdvrtlnvtmaleetlgelligfldyyanefnydrdaisirqgrrve
    rvcieepftfeaikkafreahge
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jnbE (E:)
    tlfdnhpvqqysgfnpidfrfddyvegakrfdnlanlirsstptdpfanyqkpceststs
    rsrtnsakdqkhgp
    

    Sequence, based on observed residues (ATOM records):
    >5jnbE (E:)
    tlfdnhpvqqysgfnpidfrfddyvegakrfdnlanlirsstptdp
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jnbF (F:)
    tlfdnhpvqqysgfnpidfrfddyvegakrfdnlanlirsstptdpfanyqkpceststs
    rsrtnsakdqkhgp
    

    Sequence, based on observed residues (ATOM records):
    >5jnbF (F:)
    tlfdnhpvqqysgfnpidfrfddyvegakrfdnlanlirsstptdp
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5jnbG (G:)
    tlfdnhpvqqysgfnpidfrfddyvegakrfdnlanlirsstptdpfanyqkpceststs
    rsrtnsakdqkhgp
    

    Sequence, based on observed residues (ATOM records):
    >5jnbG (G:)
    idfrfddyvegakrfdnlanlirsstpt
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5jnbH (H:)
    tlfdnhpvqqysgfnpidfrfddyvegakrfdnlanlirsstptdpfanyqkpceststs
    rsrtnsakdqkhgp
    

    Sequence, based on observed residues (ATOM records):
    >5jnbH (H:)
    frfddyvegakrfdnlanlirsstp