PDB entry 5jn8

View 5jn8 on RCSB PDB site
Description: Crystal Structure for the complex of human carbonic anhydrase IV and acetazolamide
Class: lyase/lyase inhibitor
Keywords: Carbonic anhydrase, Lyase, Inhibitor binding, lyase-lyase inhibitor complex
Deposited on 2016-04-29, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jn8a_
  • Chain 'B':
    Compound: Carbonic anhydrase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jn8b_
  • Chain 'C':
    Compound: Carbonic anhydrase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jn8c_
  • Chain 'D':
    Compound: Carbonic anhydrase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jn8d_
  • Heterogens: AZM, ZN, SO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jn8A (A:)
    aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
    qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
    mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
    maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
    dkeqtvsmkdnvrplqqlgqrtviks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jn8A (A:)
    aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
    qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
    mhivhekekgtsdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaessll
    dllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvs
    mkdnvrplqqlgqrtviks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jn8B (B:)
    aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
    qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
    mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
    maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
    dkeqtvsmkdnvrplqqlgqrtviks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jn8B (B:)
    hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
    tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
    vhekekgtdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllp
    keeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdn
    vrplqqlgqrtviks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jn8C (C:)
    aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
    qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
    mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
    maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
    dkeqtvsmkdnvrplqqlgqrtviks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jn8C (C:)
    shwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqt
    wtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemh
    ivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttma
    esslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydk
    eqtvsmkdnvrplqqlgqrtviks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jn8D (D:)
    aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
    qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
    mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
    maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
    dkeqtvsmkdnvrplqqlgqrtviks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jn8D (D:)
    hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
    tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
    vhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmae
    sslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydke
    qtvsmkdnvrplqqlgqrtviks