PDB entry 5jn2

View 5jn2 on RCSB PDB site
Description: crystal structure of tgcdpk1 bound to nvpacu106
Deposited on 2016-04-29, released 2016-05-25
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-domain protein kinase 1
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: CDPK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 6LO, CA, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jn2A (A:)
    mhhhhhhssgrenlyfqgmgqqestlggaageprsrghaagtsggpgdhlhatpgmfvqh
    staifsdrykgqrvlgkgsfgevilckdkitgqecavkviskrqvkqktdkesllrevql
    lkqldhpnimklyeffedkgyfylvgevytggelfdeiisrkrfsevdaariirqvlsgi
    tymhknkivhrdlkpenllleskskdaniriidfglsthfeaskkmkdkigtayyiapev
    lhgtydekcdvwstgvilyillsgcppfnganeydilkkvekgkytfelpqwkkvsesak
    dlirkmltyvpsmrisardaldhewiqtytkeqisvdvpsldnailnirqfqgtqklaqa
    allymgskltsqdetkeltaifhkmdkngdgqldraeliegykelmrmkgqdasmldasa
    vehevdqvldavdfdkngyieysefvtvamdrktllsrerlerafrmfdsdnsgkisste
    latifgvsdvdsetwksvlsevdknndgevdfdefqqmllklcgn
    

    Sequence, based on observed residues (ATOM records):
    >5jn2A (A:)
    staifsdrykgqrvlgkgsfgevilckdkitgqecavkviskrqvkqktdkesllrevql
    lkqldhpnimklyeffedkgyfylvgevytggelfdeiisrkrfsevdaariirqvlsgi
    tymhknkivhrdlkpenllleskskdaniriidfglsthfeaskkmkdkigtayyiapev
    lhgtydekcdvwstgvilyillsgcppfnganeydilkkvekgkytfelpqwkkvsesak
    dlirkmltyvpsmrisardaldhewiqtytkvpsldnailnirqfqgtqklaqaallymg
    skltsqdetkeltaifhkmdkngdgqldraeliegykelmrmkgqdasmldasavehevd
    qvldaveysefvtvamdrktllsrerlerafrmfdsdnsgkisstelatifgvsdvdset
    wksvlsevdkndgevdfdefqqmllklcgn