PDB entry 5jmx

View 5jmx on RCSB PDB site
Description: Crystal Structure of BcII metallo-beta-lactamase in complex with DZ-305
Class: hydrolase
Keywords: antimicrobial resistance, metallo beta lactamase, inhibitor, hydrolase
Deposited on 2016-04-29, released 2017-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Bacillus cereus [TaxId:1396]
    Gene: blm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jmxa_
  • Heterogens: ZN, SO4, DZ5, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jmxA (A:)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jmxA (A:)
    ktviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliem
    vekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtv
    tnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnews
    tsienvlkryrninavvpghgevgdkglllhtldllk