PDB entry 5jmo

View 5jmo on RCSB PDB site
Description: x-ray structure of furin in complex with the inhibitory antibody nb14
Deposited on 2016-04-29, released 2016-12-07
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FURIN, FUR, PACE, PCSK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09958 (Start-466)
      • expression tag (467-470)
  • Chain 'B':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FURIN, FUR, PACE, PCSK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09958 (0-466)
      • expression tag (467-470)
  • Chain 'C':
    Compound: camelid VHH fragment
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JMO (0-End)
  • Chain 'D':
    Compound: camelid VHH fragment
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JMO (0-116)
  • Chain 'G':
    Compound: CMK-inhibitor
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JMO (1-End)
  • Chain 'H':
    Compound: CMK-inhibitor
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JMO (0-5)
  • Heterogens: NAG, CA, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jmoA (A:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records):
    >5jmoA (A:)
    yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
    dwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevrk
    tvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgfn
    dwafmtthswdedpsgewvleientseannygtltkftlvlygtasgsl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jmoB (B:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records):
    >5jmoB (B:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgsl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jmoC (C:)
    qvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsntdy
    adsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records):
    >5jmoC (C:)
    qvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsntdy
    adsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5jmoD (D:)
    qvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsntdy
    adsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvss
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >5jmoG (G:)
    xrvkxx
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5jmoH (H:)
    xrvkxx