PDB entry 5jm7

View 5jm7 on RCSB PDB site
Description: the structure of aerobactin synthetase iuca from a hypervirulent pathotype of klebsiella pneumoniae
Deposited on 2016-04-28, released 2016-06-15
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aerobactin synthase IucA
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:72407]
    Gene: RJF2_26555, RJF9_26895
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jm7A (A:)
    ghmtlptktstldvaaqcflnslvretkdwrlteyqptqliiplgeqqalhfrvayfspt
    qhhrfefparlvtasgshpvdfatlsrlivdklqhqlllpatscetfhqrvmeshahtqq
    aidarhdwaalrekalnfgeaeqallvghafhpapkshepfnqqeaerylpdfaphfplr
    wfavnktqiageslhlnlqqrltrfaaenapqllnelsdnqwlfplhpwqgeyllqqewc
    qelvakglikdlgeagapwlpttssrslycatsrdmikfslsvrltnsvrtlsvkevkrg
    mrlarlaqtddwqtlqarfptfrvmqedgwaglrdlhgnimqeslfalrenllvdqpqsq
    tnvlvsltqaapdggdsllvaavkrlsdrlgitaqqaahawvdaychqvlkplftaeady
    glvllahqqnilvqmlgdlpvgliyrdcqgsafmphaagwldtigeaqaenvftreqllr
    yfpyyllvnstfavtaalgaagldseanlmarvrtllaemrdqvthktclnyvlenpywn
    vkgnffcylndhnentivdpsviyfdfanpllaqeg
    

    Sequence, based on observed residues (ATOM records):
    >5jm7A (A:)
    tldvaaqcflnslvretkdwrlteyqptqliiplgeqqalhfrvayfsptqhhrfefpar
    lvtasgshpvdfatlsrlivdklqhqlllpatscetfhqrvmeshahtqqaidarhdwaa
    lrekalnfgeaeqallvghafhpapkshepfnqqeaerylpdfaphfplrwfavnktqia
    geslhlnlqqrltrfaaenapqllnelsdnqwlfplhpwqgeyllqqewcqelvakglik
    dlgeagapwlpttssrslycatsrdmikfslstlsvkevkrgmrlarlaqtddwqtlqar
    fptfrvmqedgwaglrdlhgnimqeslfalrenllvdqpqsqtnvlvsltqaapdggdsl
    lvaavkrlsdrlgitaqqaahawvdaychqvlkplftaeadyglvllahqqnilvqmlgd
    lpvgliyrdcqgsafmphaagwldtigeaqaenvftreqllryfpyyllvnstfavtaal
    gaagldseanlmarvrtllaemrdqvthktclnyvlenpywnvkgnffcylnddpsviyf
    dfanplla