PDB entry 5jly

View 5jly on RCSB PDB site
Description: Structure of Peroxiredoxin-1 from Schistosoma japonicum
Class: oxidoreductase
Keywords: Peroxiredoxin-1, OXIDOREDUCTASE
Deposited on 2016-04-27, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin peroxidase-1
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjTPx-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jlya_
  • Chain 'B':
    Compound: Thioredoxin peroxidase-1
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjTPx-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jlyb_
  • Chain 'C':
    Compound: Thioredoxin peroxidase-1
    Species: Schistosoma japonicum [TaxId:6182]
    Gene: SjTPx-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jlyc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jlyA (A:)
    hhhhhhmvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiia
    fsdevdqfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygv
    ldeeegnafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekygevcpvnwk
    rgqhgikvnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jlyA (A:)
    mvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiiafsdevd
    qfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygvldeeeg
    nafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekyge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jlyB (B:)
    hhhhhhmvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiia
    fsdevdqfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygv
    ldeeegnafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekygevcpvnwk
    rgqhgikvnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jlyB (B:)
    mvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiiafsdevd
    qfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygvldeeeg
    nafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekyge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jlyC (C:)
    hhhhhhmvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiia
    fsdevdqfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygv
    ldeeegnafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekygevcpvnwk
    rgqhgikvnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jlyC (C:)
    mvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiiafsdevd
    qfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygvldeeeg
    nafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekyg