PDB entry 5jlu

View 5jlu on RCSB PDB site
Description: crystal structure of adhesin competence repressor (adcr) from streptococcus pyogenes
Deposited on 2016-04-27, released 2017-05-03
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adhesin competence repressor
    Species: Streptococcus pyogenes serotype M3 [TaxId:301448]
    Gene: adcR, SpyM3_0069
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jluA (A:)
    gshmgtlekkldnlvntillkaenqhellfgacqsdvkltntqehilmllsqqrltntdl
    akalnisqaavtkaikslvkqdmlagtkdtvdarvtyfeltelakpiasehthhhdetln
    vynrllqkfsakeleivdkfvtvfaeeleg
    

    Sequence, based on observed residues (ATOM records):
    >5jluA (A:)
    gtlekkldnlvntillkaenqhdvkltntqehilmllsqqrltntdlakalnisqaavtk
    aikslvkqdmlagtkdtvdarvtyfeltelakpiasehthhhdetlnvynrllqkfsake
    leivdkfvtvfaeeleg