PDB entry 5jlp

View 5jlp on RCSB PDB site
Description: crystal structure of mycobacterium avium serb2 in complex with serine at act domain
Deposited on 2016-04-27, released 2017-05-03
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine Phosphatase
    Species: Mycobacterium avium (strain 104) [TaxId:243243]
    Gene: serB, MAV_3907
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QJI1 (0-395)
      • engineered mutation (26)
  • Heterogens: EDO, PG0, MG, SER, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jlpA (A:)
    pkvsvlitvtgvdqpgvtatlfevlsrhgvellnveqvvirhrltlgvlvccpadvadgp
    alrhdveaairkvgldvsiersddvpiirepsthtifvlgrpitaaafgavarevaalgv
    nidlirgvsdypviglelrvsvppgadgalrtalnrvsseehvdvavedytlerrakrli
    vfdvdstlvqgeviemlaakagaegqvaaitdaamrgeldfaqslqqrvatlaglpatvi
    devagqlelmpgarttlrtlrrlgyacgvvsggfrriieplaeelmldyvaaneleivdg
    tltgrvvgpiidragkatalrefaqragvpmaqtvavgdgandidmlaaaglgiafnakp
    alrevadaslshpyldtvlfllgvtrgeieaadaid